(data stored in ACNUC7421 zone)

EMBL: CP001600.PE653

CP001600.PE653       Location/Qualifiers
FT   CDS             complement(694015..696354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0703"
FT                   /product="DNA polymerase family B protein"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67925"
FT                   /db_xref="GOA:C5B7P8"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P8"
FT                   /protein_id="ACR67925.1"
FT                   /translation="MNTPQPGFILTRHWRDTPQGVCVTLWLATERGPRCITLPPEPAVA
FT                   FMNAAQRDAAQHLLRGFPDVELRPVTLRDFHHQPVLALYCRGYRQLQQIERRLKAQGIP
FT                   LLEADIRPADRYLMERFINAPLWFCSDAGGAEARIKPHPHYRPTLRTVSLDIETSPRGE
FT                   LYSIGLHGCDQRIVYMLGPANGDAQALDFTLEYVASRAALLDALNRWMACHDPDAIIGW
FT                   NLVQFDLQILQRHAEREGVPLLLGRAATPLEWREHGFRAGHFFASAPGRLIIDGIEALK
FT                   SAFWHFPSYSLDSVAQTLLGEGKALDDPYRRMAEITRHFRQDKPALAHYNLRDCELVTR
FT                   IFAHTALMPFLLERASVTGLAPDRSGGSVAAFYHLYLPRMHRLGYVAPSLGEVAPQASP
FT                   GGFVMASRPGLYDSVLVLDYKSLYPAIIRSFLIDPVGLASGGEQPDDAHSVPGFLGARF
FT                   SRTRHALPEIVRQLWQGREAAKRLDNAPLAQALKILMNAFYGVLGTSACRFFDPRLASS
FT                   ITLRGHEIMRQTRSLIEALGYTVIYGDTDSTFVWLGKPHDEAQAEAIGQTLAGRVNAWW
FT                   REHLSQQYGLESALELEYECHYRRFLMPTLRGADLGSKKRYAGLCGERLVFKGLETVRS
FT                   DWTPLAQRFQQELYRRVFLGQSYRDVIRRYADGLLAGAFDDQLIYRKRLRRPLAEYQRN
FT                   VPPHVRAARLADEYNHQLERPLQYQNGGWISYIITRSGPQPLECIDAPADYQHYLERQL
FT                   QPVADAILPFLGDDFETLLTGQLGLF"
     MNTPQPGFIL TRHWRDTPQG VCVTLWLATE RGPRCITLPP EPAVAFMNAA QRDAAQHLLR        60
     GFPDVELRPV TLRDFHHQPV LALYCRGYRQ LQQIERRLKA QGIPLLEADI RPADRYLMER       120
     FINAPLWFCS DAGGAEARIK PHPHYRPTLR TVSLDIETSP RGELYSIGLH GCDQRIVYML       180
     GPANGDAQAL DFTLEYVASR AALLDALNRW MACHDPDAII GWNLVQFDLQ ILQRHAEREG       240
     VPLLLGRAAT PLEWREHGFR AGHFFASAPG RLIIDGIEAL KSAFWHFPSY SLDSVAQTLL       300
     GEGKALDDPY RRMAEITRHF RQDKPALAHY NLRDCELVTR IFAHTALMPF LLERASVTGL       360
     APDRSGGSVA AFYHLYLPRM HRLGYVAPSL GEVAPQASPG GFVMASRPGL YDSVLVLDYK       420
     SLYPAIIRSF LIDPVGLASG GEQPDDAHSV PGFLGARFSR TRHALPEIVR QLWQGREAAK       480
     RLDNAPLAQA LKILMNAFYG VLGTSACRFF DPRLASSITL RGHEIMRQTR SLIEALGYTV       540
     IYGDTDSTFV WLGKPHDEAQ AEAIGQTLAG RVNAWWREHL SQQYGLESAL ELEYECHYRR       600
     FLMPTLRGAD LGSKKRYAGL CGERLVFKGL ETVRSDWTPL AQRFQQELYR RVFLGQSYRD       660
     VIRRYADGLL AGAFDDQLIY RKRLRRPLAE YQRNVPPHVR AARLADEYNH QLERPLQYQN       720
     GGWISYIITR SGPQPLECID APADYQHYLE RQLQPVADAI LPFLGDDFET LLTGQLGLF        779
//

If you have problems or comments...

PBIL Back to PBIL home page