(data stored in ACNUC7421 zone)

EMBL: CP001600.PE654

CP001600.PE654       Location/Qualifiers
FT   CDS             complement(696496..697209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0704"
FT                   /product="thiamine ABC transporter, ATP-binding protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67926"
FT                   /db_xref="GOA:C5B7P9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P9"
FT                   /protein_id="ACR67926.1"
FT                   /translation="MIRLDNLNYRYQRQTLSFSLHAAVGERIAILGPSGAGKSTLLSLI
FT                   AGFLAPSSGNLYLNGIDCHRAPPSQRPVSMLFQEHNLFAHLTIAQNLGLGLNPALRLNA
FT                   DQRRQLEEIAGQVGILDYLPRLPGQLSGGQRQRAALARCLLRRQPILLLDEPFSALDPA
FT                   LRAEMLTLLDDICRQRQLTLLMVSHNLDDAACIAPRTLVIDDGCVAYDGPTVALLAGSV
FT                   AAARLLGREVLGLTE"
     MIRLDNLNYR YQRQTLSFSL HAAVGERIAI LGPSGAGKST LLSLIAGFLA PSSGNLYLNG        60
     IDCHRAPPSQ RPVSMLFQEH NLFAHLTIAQ NLGLGLNPAL RLNADQRRQL EEIAGQVGIL       120
     DYLPRLPGQL SGGQRQRAAL ARCLLRRQPI LLLDEPFSAL DPALRAEMLT LLDDICRQRQ       180
     LTLLMVSHNL DDAACIAPRT LVIDDGCVAY DGPTVALLAG SVAAARLLGR EVLGLTE          237
//

If you have problems or comments...

PBIL Back to PBIL home page