(data stored in ACNUC7421 zone)

EMBL: CP001600.PE655

CP001600.PE655       Location/Qualifiers
FT   CDS             complement(697206..698813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0705"
FT                   /product="thiamine/thiamine pyrophosphate ABC transporter,
FT                   permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67927"
FT                   /db_xref="GOA:C5B7Q0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q0"
FT                   /protein_id="ACR67927.1"
FT                   /translation="MAKRPEPLIPRWLWPGLLAAALLLSIALLAFGALYHSAPSGAPVA
FT                   MWQDAYLWHVVRFSFWQALLSTLLSLLPAIALALALFRRRFPGRALLLRLCAMTLVLPV
FT                   LVAVFGLLSVYGRQGWLALLCQTLGIDYHFSPYGLQGILLAHVFFNLPLATRLLLQALE
FT                   SIPVEQRQLAAQLDMSPHQILRFVEWPYLRRQLPPAGALIFMLCFSSFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDPARAAQLALLQLGCCLGLVVLSQRLSGILPVGHTRRMRWRDT
FT                   RDSLRLKLSDTLTIGLALLLLLPPLLAVIVDGLNQALGSVLRQPALWQALGTSLYIALG
FT                   AGALTVSLTMMLLWSSRELILRGQRWRAQGMELCGMLILAMPGIVLATGFFLLLNATIG
FT                   LPTSPGLLVMVTNALMAIPYAMKVLEYPMRDLAERYDPLCLSLRIGGLNRLRWIELRAL
FT                   RRPLAQALAFACVLSLGDFGVVALFGSEQFRTLPFYLYQQLGAYRSADGAVTALLLLLF
FT                   CLTLFSLLERLPTGRKSP"
     MAKRPEPLIP RWLWPGLLAA ALLLSIALLA FGALYHSAPS GAPVAMWQDA YLWHVVRFSF        60
     WQALLSTLLS LLPAIALALA LFRRRFPGRA LLLRLCAMTL VLPVLVAVFG LLSVYGRQGW       120
     LALLCQTLGI DYHFSPYGLQ GILLAHVFFN LPLATRLLLQ ALESIPVEQR QLAAQLDMSP       180
     HQILRFVEWP YLRRQLPPAG ALIFMLCFSS FATVLSLGGG PQATTIELAI YQALSYDYDP       240
     ARAAQLALLQ LGCCLGLVVL SQRLSGILPV GHTRRMRWRD TRDSLRLKLS DTLTIGLALL       300
     LLLPPLLAVI VDGLNQALGS VLRQPALWQA LGTSLYIALG AGALTVSLTM MLLWSSRELI       360
     LRGQRWRAQG MELCGMLILA MPGIVLATGF FLLLNATIGL PTSPGLLVMV TNALMAIPYA       420
     MKVLEYPMRD LAERYDPLCL SLRIGGLNRL RWIELRALRR PLAQALAFAC VLSLGDFGVV       480
     ALFGSEQFRT LPFYLYQQLG AYRSADGAVT ALLLLLFCLT LFSLLERLPT GRKSP            535
//

If you have problems or comments...

PBIL Back to PBIL home page