(data stored in ACNUC7421 zone)

EMBL: CP001600.PE656

CP001600.PE656       Location/Qualifiers
FT   CDS             complement(698789..699784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0706"
FT                   /product="thiamin/thiamine pyrophosphate ABC transporter,
FT                   thiamin/thiamine pyrophospate-binding protein, putative"
FT                   /note="thiamin/thiamin pyrophosphate ABC transporter,
FT                   thiamin/thiamin pyrophospate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67928"
FT                   /db_xref="GOA:C5B7Q1"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q1"
FT                   /protein_id="ACR67928.1"
FT                   /translation="MLKKLFSILALLTVSLLAQAAGKPVLTVYTYDSFAADWGPGPKIK
FT                   QAFEQSCHCELRLVPLEDGVAILNRLRMEGKNSPADLVLGLDNNLLTAARHSGLFSPSQ
FT                   IDTRGQQIPGGWHDATFVPYDYGYFAFVYDRQQVKNPPSSLKQLVEGPEKWRVIYQDPR
FT                   TSTPGLGLLLWMQKVYGDQAPAAWQKLAQKTVTVTKGWSEAYGLFLKGEADMVLSYTTS
FT                   PAYHIIEEHNDRYATAMFDEGHYLQVEVAGILKHSRQPALAHQFMQFITTPAFQNAIPT
FT                   GNWMYPATAVPLPPAFAALPRPQKTLSFTADDVAQHRAEWIRAWQSALSR"
     MLKKLFSILA LLTVSLLAQA AGKPVLTVYT YDSFAADWGP GPKIKQAFEQ SCHCELRLVP        60
     LEDGVAILNR LRMEGKNSPA DLVLGLDNNL LTAARHSGLF SPSQIDTRGQ QIPGGWHDAT       120
     FVPYDYGYFA FVYDRQQVKN PPSSLKQLVE GPEKWRVIYQ DPRTSTPGLG LLLWMQKVYG       180
     DQAPAAWQKL AQKTVTVTKG WSEAYGLFLK GEADMVLSYT TSPAYHIIEE HNDRYATAMF       240
     DEGHYLQVEV AGILKHSRQP ALAHQFMQFI TTPAFQNAIP TGNWMYPATA VPLPPAFAAL       300
     PRPQKTLSFT ADDVAQHRAE WIRAWQSALS R                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page