(data stored in ACNUC7421 zone)

EMBL: CP001600.PE658

CP001600.PE658       Location/Qualifiers
FT   CDS             701745..701858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0709"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67930"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q3"
FT                   /protein_id="ACR67930.1"
FT                   /translation="MFLSKGAFHRPAIVDRWFFLFSVGCGGKTGYSVAALM"
     MFLSKGAFHR PAIVDRWFFL FSVGCGGKTG YSVAALM                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page