(data stored in ACNUC7421 zone)

EMBL: CP001600.PE66

CP001600.PE66        Location/Qualifiers
FT   CDS             complement(60550..61683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0069"
FT                   /product="O-antigen ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67329"
FT                   /db_xref="GOA:C5BB94"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB94"
FT                   /protein_id="ACR67329.1"
FT                   /translation="MKTNFINKLPIYISALFCVFVSLLSISDDNNLVSNIYYVSFALFI
FT                   VWCVCERKNIFNKTSLLLGVFLLFSAISTYWSDHSKDTSRYIQHAIYIFIFSSMIYELR
FT                   STLFFKNILFKSYVATCSIFVVVNGFIFYSKYSLYDRFYPILGPSNTIDYAGILCLAII
FT                   FCCYLYQHEKNKSPYIIAGIVLLAGVILSQSRTPIIALAISLMAIFIKRKRSAIISLVS
FT                   ILAIILLVHTVYPSIFTRDAVDGAPTPRIFTWLYTIQQVSEHHPWLGFGYSDTFAHYFK
FT                   PRNFTYNNAHSVFMSMLYYSGIIGVILFFSYILNIFSVAIKIFNKNRYPIAFILISLIF
FT                   SSTQGYIYIYHPREIWLVLWLPLFLAIPMSKRSSEQL"
     MKTNFINKLP IYISALFCVF VSLLSISDDN NLVSNIYYVS FALFIVWCVC ERKNIFNKTS        60
     LLLGVFLLFS AISTYWSDHS KDTSRYIQHA IYIFIFSSMI YELRSTLFFK NILFKSYVAT       120
     CSIFVVVNGF IFYSKYSLYD RFYPILGPSN TIDYAGILCL AIIFCCYLYQ HEKNKSPYII       180
     AGIVLLAGVI LSQSRTPIIA LAISLMAIFI KRKRSAIISL VSILAIILLV HTVYPSIFTR       240
     DAVDGAPTPR IFTWLYTIQQ VSEHHPWLGF GYSDTFAHYF KPRNFTYNNA HSVFMSMLYY       300
     SGIIGVILFF SYILNIFSVA IKIFNKNRYP IAFILISLIF SSTQGYIYIY HPREIWLVLW       360
     LPLFLAIPMS KRSSEQL                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page