(data stored in ACNUC7421 zone)

EMBL: CP001600.PE660

CP001600.PE660       Location/Qualifiers
FT   CDS             complement(703495..704361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0711"
FT                   /product="ABC transporter, ATP-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67932"
FT                   /db_xref="GOA:C5B7Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q5"
FT                   /protein_id="ACR67932.1"
FT                   /translation="MRALFESIGQVIDSIHTVANDIDVADKPGAAPLRLTHGEIRFNTV
FT                   CFGYPAGQILFDRLDLHIRPGEKVALVGRSGAGKSSLMHLLLRFYDLQSGSITLDAQNI
FT                   AEVTQTSLRRQIGMITQDTALLHRSIRENLMYGNPQASEAEMIAACRRAEAHDFISQLA
FT                   DDVGNRGYDTQVGERGVKLSGGQRQRIAIARVLLKDAPILIMDEATSALDSEAEAAIQD
FT                   NLAQMMAGKTVIAIAHRLSTIAAMDRLIVMDHGRIVAQGSHRELLQQNGIYARLWAHQT
FT                   GGFIGND"
     MRALFESIGQ VIDSIHTVAN DIDVADKPGA APLRLTHGEI RFNTVCFGYP AGQILFDRLD        60
     LHIRPGEKVA LVGRSGAGKS SLMHLLLRFY DLQSGSITLD AQNIAEVTQT SLRRQIGMIT       120
     QDTALLHRSI RENLMYGNPQ ASEAEMIAAC RRAEAHDFIS QLADDVGNRG YDTQVGERGV       180
     KLSGGQRQRI AIARVLLKDA PILIMDEATS ALDSEAEAAI QDNLAQMMAG KTVIAIAHRL       240
     STIAAMDRLI VMDHGRIVAQ GSHRELLQQN GIYARLWAHQ TGGFIGND                    288
//

If you have problems or comments...

PBIL Back to PBIL home page