(data stored in ACNUC7421 zone)

EMBL: CP001600.PE661

CP001600.PE661       Location/Qualifiers
FT   CDS             complement(704345..705313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0712"
FT                   /product="ABC-type multidrug transport family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67933"
FT                   /db_xref="GOA:C5B7Q6"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q6"
FT                   /protein_id="ACR67933.1"
FT                   /translation="MFHWFERLTEPFPSQDPQKPPATLFGFCRHYTRGFERPLCAMALL
FT                   SAAVAVCEVILLRYLGELVDLLSHAERATFWADQRPSLIGMTILVLVVMPLLAWLHSNL
FT                   LHQSILGNYPMAVRWQVHRYLLGQSIAFFQRDFAGRVAAKVMQSAQSVREVVMKMVDLL
FT                   IYILVYLLSVLVMIASVDALLLIPLLLWLATYTLIQIHLLPRLRRIASEQANAQSMMSG
FT                   TIVDTYTHITTVKLFSHDQRESDYARHAMQRYLATVYRQMRTLTGLLFSVDVINYLLLF
FT                   SLAALSIALWQQQARYRHRHQSCPASTGHVQVDYVGGARTV"
     MFHWFERLTE PFPSQDPQKP PATLFGFCRH YTRGFERPLC AMALLSAAVA VCEVILLRYL        60
     GELVDLLSHA ERATFWADQR PSLIGMTILV LVVMPLLAWL HSNLLHQSIL GNYPMAVRWQ       120
     VHRYLLGQSI AFFQRDFAGR VAAKVMQSAQ SVREVVMKMV DLLIYILVYL LSVLVMIASV       180
     DALLLIPLLL WLATYTLIQI HLLPRLRRIA SEQANAQSMM SGTIVDTYTH ITTVKLFSHD       240
     QRESDYARHA MQRYLATVYR QMRTLTGLLF SVDVINYLLL FSLAALSIAL WQQQARYRHR       300
     HQSCPASTGH VQVDYVGGAR TV                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page