(data stored in ACNUC7421 zone)

EMBL: CP001600.PE662

CP001600.PE662       Location/Qualifiers
FT   CDS             705425..706198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0713"
FT                   /product="ABC transporter, ATP-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67934"
FT                   /db_xref="GOA:C5B7Q7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q7"
FT                   /protein_id="ACR67934.1"
FT                   /translation="MFSLTNLEVVRGGREVLVIEQLTIPTDRLTVILGHNGSGKSTLVS
FT                   LLAGQLRPDGGQIALDGQALSSLSAGALARRVAFLPQKLPTSAGLTVRELVRLGRFPWR
FT                   GMLGRWRREDRQLIDAAMAETGVTPFAETLVDTLSGGERQRAWVAMLLAQASPLLILDE
FT                   PTSALDIQHQYQLMALLSALPRGVLVILHDLNLALRYADHVIALKQGRVAFAGPAAALA
FT                   DERRLSELYQTPIRLTDHPHPAPGAPPHKVAIVCA"
     MFSLTNLEVV RGGREVLVIE QLTIPTDRLT VILGHNGSGK STLVSLLAGQ LRPDGGQIAL        60
     DGQALSSLSA GALARRVAFL PQKLPTSAGL TVRELVRLGR FPWRGMLGRW RREDRQLIDA       120
     AMAETGVTPF AETLVDTLSG GERQRAWVAM LLAQASPLLI LDEPTSALDI QHQYQLMALL       180
     SALPRGVLVI LHDLNLALRY ADHVIALKQG RVAFAGPAAA LADERRLSEL YQTPIRLTDH       240
     PHPAPGAPPH KVAIVCA                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page