(data stored in ACNUC7421 zone)

EMBL: CP001600.PE663

CP001600.PE663       Location/Qualifiers
FT   CDS             706189..707121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0714"
FT                   /product="iron periplasmic binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67935"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q8"
FT                   /protein_id="ACR67935.1"
FT                   /translation="MCLIFNFIFRFFAPLALLFSLFSPSAQALTVSDSRGTHQLPAVPT
FT                   RAVVLDWDLLEQTIELGVTPLAATDLDSYREWVAQPPIPAQTQSVGSREEPNLERIAAL
FT                   KPDVILASEMQQALLPRLMQIAPVLYYTNFSAADDHAAVAIAQFRQLAQAFGREAIAEQ
FT                   KLAAMQARFQHLSRALRAAFQGQLPAVTVMRFASTTSTYLYTTNSMPVYVLRQLGISPA
FT                   LTPPPARWGIVRQPIAGLQRVGQGYVLYFLPFHDAARLDAMRLWQAMPFVRGQRVSAVR
FT                   PVWSYGGAMSLQYAAEAMAESLMALAAQK"
     MCLIFNFIFR FFAPLALLFS LFSPSAQALT VSDSRGTHQL PAVPTRAVVL DWDLLEQTIE        60
     LGVTPLAATD LDSYREWVAQ PPIPAQTQSV GSREEPNLER IAALKPDVIL ASEMQQALLP       120
     RLMQIAPVLY YTNFSAADDH AAVAIAQFRQ LAQAFGREAI AEQKLAAMQA RFQHLSRALR       180
     AAFQGQLPAV TVMRFASTTS TYLYTTNSMP VYVLRQLGIS PALTPPPARW GIVRQPIAGL       240
     QRVGQGYVLY FLPFHDAARL DAMRLWQAMP FVRGQRVSAV RPVWSYGGAM SLQYAAEAMA       300
     ESLMALAAQK                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page