(data stored in ACNUC7421 zone)

EMBL: CP001600.PE664

CP001600.PE664       Location/Qualifiers
FT   CDS             707118..709112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0715"
FT                   /product="ABC transporter, iron chelate uptake transporter
FT                   family, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67936"
FT                   /db_xref="GOA:C5B7Q9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q9"
FT                   /protein_id="ACR67936.1"
FT                   /translation="MSGAVRLAAPLLLLTLAVASLQWAQPLTLLQQWQLLLAPQQAQSL
FT                   DDILWLYSQLPRLAITLLVGATLGLAGSVMQQLTQNALMSPLTMGTSSGAWLALVLLAA
FT                   FWPGQQAQWGALAAMGGALLAFALIVLIAGLDNMTGLPMVIAGMVINILLGALASGVLL
FT                   LQHPYAQNIFLWGSGDLAQSDWGWVRWLLPRLTPALLLLLFAPRVLELLRLGHQGAQAR
FT                   GVALVPLFFALMLLTIWLVSAAVTAVGLIGFIGLLTPNIVRALGVRTPRGELYASLLGG
FT                   ALLLLLTDALAQGVSLWLGQLLPTGVVAAAIGAPALILFSRRRLSAPDGLGAPLISARG
FT                   RVSAWVSVALTALAALALLGYLTYQPEAAGWPFAWPQAYQWALRWPRALAALSCGGALA
FT                   LAGVLLQRLMYNPLASPDLLGVSSGATLTLVLAMLWCGQTLTALQQWGVGLAGSLAVLA
FT                   ALMALGRRQRYAPASVILSGIALTALLQALVQFCLAQGGQDSYRILQWLAGSTYRVTAA
FT                   QALLLSALTALLLLLALFVSRALTLLSIGRAFSQARGLNGAGAAALLLVLVALLCAIAT
FT                   AAIGPVAFVGLMAPHLAQMLGARTARAQMGLAALLGAATLLWADWLGQVLLYPRAMAAG
FT                   TLVAIVGAAYFLLLLIAGRLTRRRLQRVA"
     MSGAVRLAAP LLLLTLAVAS LQWAQPLTLL QQWQLLLAPQ QAQSLDDILW LYSQLPRLAI        60
     TLLVGATLGL AGSVMQQLTQ NALMSPLTMG TSSGAWLALV LLAAFWPGQQ AQWGALAAMG       120
     GALLAFALIV LIAGLDNMTG LPMVIAGMVI NILLGALASG VLLLQHPYAQ NIFLWGSGDL       180
     AQSDWGWVRW LLPRLTPALL LLLFAPRVLE LLRLGHQGAQ ARGVALVPLF FALMLLTIWL       240
     VSAAVTAVGL IGFIGLLTPN IVRALGVRTP RGELYASLLG GALLLLLTDA LAQGVSLWLG       300
     QLLPTGVVAA AIGAPALILF SRRRLSAPDG LGAPLISARG RVSAWVSVAL TALAALALLG       360
     YLTYQPEAAG WPFAWPQAYQ WALRWPRALA ALSCGGALAL AGVLLQRLMY NPLASPDLLG       420
     VSSGATLTLV LAMLWCGQTL TALQQWGVGL AGSLAVLAAL MALGRRQRYA PASVILSGIA       480
     LTALLQALVQ FCLAQGGQDS YRILQWLAGS TYRVTAAQAL LLSALTALLL LLALFVSRAL       540
     TLLSIGRAFS QARGLNGAGA AALLLVLVAL LCAIATAAIG PVAFVGLMAP HLAQMLGART       600
     ARAQMGLAAL LGAATLLWAD WLGQVLLYPR AMAAGTLVAI VGAAYFLLLL IAGRLTRRRL       660
     QRVA                                                                    664
//

If you have problems or comments...

PBIL Back to PBIL home page