(data stored in ACNUC7421 zone)

EMBL: CP001600.PE665

CP001600.PE665       Location/Qualifiers
FT   CDS             709224..711389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0716"
FT                   /product="TonB-dependent siderophore receptor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67937"
FT                   /db_xref="GOA:C5B7R0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7R0"
FT                   /protein_id="ACR67937.2"
FT                   /translation="MSSLRLSHMGVGLLGAISLGCTSAAMAEESARPADEITVSGSQVA
FT                   LGDSYEGGQVARTGRLGMLGNSDFMDAPFILTSYTSALIEQQQAASVADVLQNDPTVRV
FT                   AKGFGNFQELYMIRGFPVYSDDMTLNGVYGILPRQFVAAEMLERVEVLRGANTFLNGAA
FT                   PGGSAVGGMVNLVPKRAGHTPLTRVTGGVQGDGQGYAALDVARRFGDDEANGVRVNLVG
FT                   RDGKSAVAREKQRLGALSVGFDHRRDRLQLSADIGYQDHHIDAPRPSVTPGGATLPAAP
FT                   SASKNYAQDWTYADEKQLFGVVRGEYLLNDNTRVWLGAGARQGKEHNLLANPTADGDGG
FT                   LSAFLFENVRQDNVLSADVGVRHDLITGSINHTLTLSAAAYQLRSKNAWAMSSTFSGFG
FT                   TLNDMWSVARPEATFFGGSLSDARETERNSSHSVALADTLGMLEDKIKLTLGGRWQRLE
FT                   TRSYDYDSGALSARYGKNALTPFVGALYQPSLEVALFANYAEALLPSGVAPATSNGVTV
FT                   SNAGQVFAPFRAQQIEAGAKYDNGMFGASVSLFQITRPEFRLDGTTYTDNGEQRNRGIE
FT                   LTLFGKPHERVTMLGGVTLLDARQQKSSPGGQDGKRAIGVPAVQANLNLGWETPFIDGL
FT                   ALEGRAVYTASQYADAANTLSIPAWVRVDLGARYALKLDGHDVTLRARVENLSDKRYWS
FT                   SVGGYPGSNYLVQGNPRTVIVSASYDF"
     MSSLRLSHMG VGLLGAISLG CTSAAMAEES ARPADEITVS GSQVALGDSY EGGQVARTGR        60
     LGMLGNSDFM DAPFILTSYT SALIEQQQAA SVADVLQNDP TVRVAKGFGN FQELYMIRGF       120
     PVYSDDMTLN GVYGILPRQF VAAEMLERVE VLRGANTFLN GAAPGGSAVG GMVNLVPKRA       180
     GHTPLTRVTG GVQGDGQGYA ALDVARRFGD DEANGVRVNL VGRDGKSAVA REKQRLGALS       240
     VGFDHRRDRL QLSADIGYQD HHIDAPRPSV TPGGATLPAA PSASKNYAQD WTYADEKQLF       300
     GVVRGEYLLN DNTRVWLGAG ARQGKEHNLL ANPTADGDGG LSAFLFENVR QDNVLSADVG       360
     VRHDLITGSI NHTLTLSAAA YQLRSKNAWA MSSTFSGFGT LNDMWSVARP EATFFGGSLS       420
     DARETERNSS HSVALADTLG MLEDKIKLTL GGRWQRLETR SYDYDSGALS ARYGKNALTP       480
     FVGALYQPSL EVALFANYAE ALLPSGVAPA TSNGVTVSNA GQVFAPFRAQ QIEAGAKYDN       540
     GMFGASVSLF QITRPEFRLD GTTYTDNGEQ RNRGIELTLF GKPHERVTML GGVTLLDARQ       600
     QKSSPGGQDG KRAIGVPAVQ ANLNLGWETP FIDGLALEGR AVYTASQYAD AANTLSIPAW       660
     VRVDLGARYA LKLDGHDVTL RARVENLSDK RYWSSVGGYP GSNYLVQGNP RTVIVSASYD       720
     F                                                                       721
//

If you have problems or comments...

PBIL Back to PBIL home page