(data stored in ACNUC7421 zone)

EMBL: CP001600.PE7

CP001600.PE7         Location/Qualifiers
FT   CDS             complement(8477..8746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0007"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67269"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD1"
FT                   /protein_id="ACR67269.1"
FT                   /translation="MTRVGPHQGYYAGTKNDLQMISSEESGWVMRPLLVLDLPLSALVD
FT                   TLLLPYDYYRTDDEPATESPRARVQRAEQASATNGMVPPAAPEN"
     MTRVGPHQGY YAGTKNDLQM ISSEESGWVM RPLLVLDLPL SALVDTLLLP YDYYRTDDEP        60
     ATESPRARVQ RAEQASATNG MVPPAAPEN                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page