(data stored in ACNUC7421 zone)

EMBL: CP001600.PE72

CP001600.PE72        Location/Qualifiers
FT   CDS             complement(67220..68740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0075"
FT                   /product="Mg chelatase-like protein"
FT                   /note="Mg chelatase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67335"
FT                   /db_xref="GOA:C5BBA0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA0"
FT                   /protein_id="ACR67335.1"
FT                   /translation="MTLATVYTRAALGIQAPEVRIEAHIGNGLPGFTLVGLPETAVREA
FT                   KDRVRCAMLNSGFQFPPKRITLNLAPADLPKEGGRYDLPMALALLLASGQLAPHVSVCN
FT                   YEFIGELALSGDLRPVQGALPAALSAAHAKRTLIAPSDNAAELGLLAAPRPPIAPSLLA
FT                   VCAFLSGQASLEAAPAGEMTSGGTDTGDMADIIGQAQARRALEIAAAGGHNLLLIGPPG
FT                   TGKTMLACRLPGLLPPMTPDEALEQAAISSLAYPGTMPPRYGVRPFRAPHHSASMAALI
FT                   GGGPLPKPGEISLAHHGVLFLDELAEFDRRTLDALREPLESGVVHLSRARIKVSFPARV
FT                   QLVAAMNPSSGGHADGRDRRAAAAQVLRYLSRLSGPLLDRFDLSIDVPPLSPGLLARQR
FT                   ADGEDSATLRRRVCAARVRQYARGGRLNAHLEGAARDRDCRLAPDDALYLEQALTRLAL
FT                   SVRAWHRLLKVARTLADLEGCDNIARRHLAEALSYRAMDRLLLTLQRG"
     MTLATVYTRA ALGIQAPEVR IEAHIGNGLP GFTLVGLPET AVREAKDRVR CAMLNSGFQF        60
     PPKRITLNLA PADLPKEGGR YDLPMALALL LASGQLAPHV SVCNYEFIGE LALSGDLRPV       120
     QGALPAALSA AHAKRTLIAP SDNAAELGLL AAPRPPIAPS LLAVCAFLSG QASLEAAPAG       180
     EMTSGGTDTG DMADIIGQAQ ARRALEIAAA GGHNLLLIGP PGTGKTMLAC RLPGLLPPMT       240
     PDEALEQAAI SSLAYPGTMP PRYGVRPFRA PHHSASMAAL IGGGPLPKPG EISLAHHGVL       300
     FLDELAEFDR RTLDALREPL ESGVVHLSRA RIKVSFPARV QLVAAMNPSS GGHADGRDRR       360
     AAAAQVLRYL SRLSGPLLDR FDLSIDVPPL SPGLLARQRA DGEDSATLRR RVCAARVRQY       420
     ARGGRLNAHL EGAARDRDCR LAPDDALYLE QALTRLALSV RAWHRLLKVA RTLADLEGCD       480
     NIARRHLAEA LSYRAMDRLL LTLQRG                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page