(data stored in ACNUC7421 zone)

EMBL: CP001600.PE74

CP001600.PE74        Location/Qualifiers
FT   CDS             70627..72276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0077"
FT                   /product="acetolactate synthase isozyme II, large subunit,
FT                   putative"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67337"
FT                   /db_xref="GOA:C5BBA2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA2"
FT                   /protein_id="ACR67337.1"
FT                   /translation="MNGAQWVVQALRAQGVNQVFGYPGGAIMPLYDALYDGGVAHLLCR
FT                   HEQGAVMAAIGYARASGRVGVCIATSGPGATNLITGLADAMMDSVPLVAITGQVASALI
FT                   GTDAFQEMDVLGLSLACTKHSFMVTSLAELPEVMDRAFAIAVQGRPGPVLIDIPKDIQL
FT                   AQGDLATPLCSVAQVQPSCPPAALAQARAMLTQAQRPVLYVGGGVGMAGAVPSLRSLVS
FT                   RSGMPVAATLKGLGAADDRHPAYLGMLGMHGCKAANLAVQQCDLLIAVGARFDDRVTGR
FT                   LDAFAPQAQVIHLDIDPAELGKVRQAHVSLCGDLNLLLSALTMRLEIAPWLQQVAALKA
FT                   QHAWRYDHPGEAIYAPLFLRQLSGCKPPQAVVTTDVGQHQMWSAQHMRFSLPQDFITSS
FT                   GLGTMGFGIPAAVGAQVARPDDCVICVSGDGSFMMNVQELGTIKRARLPLKIVLLDNQR
FT                   LGMVRQWQQLFFDARYSETDLSDNPDFLTLAQAFGIPGQRISRKAQVAEALEALFSTPG
FT                   PYLLQVAIDEFENVWPLVPPGAGNESMLENVS"
     MNGAQWVVQA LRAQGVNQVF GYPGGAIMPL YDALYDGGVA HLLCRHEQGA VMAAIGYARA        60
     SGRVGVCIAT SGPGATNLIT GLADAMMDSV PLVAITGQVA SALIGTDAFQ EMDVLGLSLA       120
     CTKHSFMVTS LAELPEVMDR AFAIAVQGRP GPVLIDIPKD IQLAQGDLAT PLCSVAQVQP       180
     SCPPAALAQA RAMLTQAQRP VLYVGGGVGM AGAVPSLRSL VSRSGMPVAA TLKGLGAADD       240
     RHPAYLGMLG MHGCKAANLA VQQCDLLIAV GARFDDRVTG RLDAFAPQAQ VIHLDIDPAE       300
     LGKVRQAHVS LCGDLNLLLS ALTMRLEIAP WLQQVAALKA QHAWRYDHPG EAIYAPLFLR       360
     QLSGCKPPQA VVTTDVGQHQ MWSAQHMRFS LPQDFITSSG LGTMGFGIPA AVGAQVARPD       420
     DCVICVSGDG SFMMNVQELG TIKRARLPLK IVLLDNQRLG MVRQWQQLFF DARYSETDLS       480
     DNPDFLTLAQ AFGIPGQRIS RKAQVAEALE ALFSTPGPYL LQVAIDEFEN VWPLVPPGAG       540
     NESMLENVS                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page