(data stored in ACNUC7421 zone)

EMBL: CP001600.PE75

CP001600.PE75        Location/Qualifiers
FT   CDS             72273..72563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0078"
FT                   /product="acetolactate synthase isozyme II, small subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67338"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA3"
FT                   /protein_id="ACR67338.1"
FT                   /translation="MMQSPSFQHHLAIQARRRPEILERVLRVVRHRGFEIHAMNMAQDG
FT                   DCDSVNIELTVASTRPVTLLSSQLIKLLDVARVDVSAPRSLRMLPRRQVLG"
     MMQSPSFQHH LAIQARRRPE ILERVLRVVR HRGFEIHAMN MAQDGDCDSV NIELTVASTR        60
     PVTLLSSQLI KLLDVARVDV SAPRSLRMLP RRQVLG                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page