(data stored in ACNUC7421 zone)

EMBL: CP001600.PE76

CP001600.PE76        Location/Qualifiers
FT   CDS             72617..73546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0079"
FT                   /product="branched-chain amino acid aminotransferase,
FT                   putative"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67339"
FT                   /db_xref="GOA:C5BBA4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA4"
FT                   /protein_id="ACR67339.1"
FT                   /translation="MTTKKADYIWFNGDMVPWGEARVHVMSHALHYGTSVFEGVRCYET
FT                   HRGPAVFRHREHMQRLHDSARIYRMPLAYSVEELMAACRETLRRNQLSSAYIRPLVFIG
FT                   DVGMGVNPPAGYGTDVILAAFPWGAYLGEEALEQGIDAMVSSWHRAAPNTIPTAAKAGG
FT                   NYLSSLLVGSEARRHGYQEGIALDVHGYVSEGAGENLFMVKNGVIFTPPFTSAALPGIT
FT                   RDAIITLAQAQGLEVREQVLSREALYLADEIFMSGTAAEITPVRSVDGIQVGIGRCGPI
FT                   TKRVQQAFFGLFNGQTEDRFGWLDPVNP"
     MTTKKADYIW FNGDMVPWGE ARVHVMSHAL HYGTSVFEGV RCYETHRGPA VFRHREHMQR        60
     LHDSARIYRM PLAYSVEELM AACRETLRRN QLSSAYIRPL VFIGDVGMGV NPPAGYGTDV       120
     ILAAFPWGAY LGEEALEQGI DAMVSSWHRA APNTIPTAAK AGGNYLSSLL VGSEARRHGY       180
     QEGIALDVHG YVSEGAGENL FMVKNGVIFT PPFTSAALPG ITRDAIITLA QAQGLEVREQ       240
     VLSREALYLA DEIFMSGTAA EITPVRSVDG IQVGIGRCGP ITKRVQQAFF GLFNGQTEDR       300
     FGWLDPVNP                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page