(data stored in ACNUC7421 zone)

EMBL: CP001600.PE8

CP001600.PE8         Location/Qualifiers
FT   CDS             8829..8963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67270"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD2"
FT                   /protein_id="ACR67270.1"
FT                   /translation="MSSWADSNLPPSLSATLLSIYRNIDAVFVFQPNFINLCCIIKFR"
     MSSWADSNLP PSLSATLLSI YRNIDAVFVF QPNFINLCCI IKFR                         44
//

If you have problems or comments...

PBIL Back to PBIL home page