(data stored in ACNUC7421 zone)

EMBL: CP001600.PE81

CP001600.PE81        Location/Qualifiers
FT   CDS             complement(79763..79900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0084"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67344"
FT                   /db_xref="GOA:C5BBA9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA9"
FT                   /protein_id="ACR67344.1"
FT                   /translation="MARRAAALHILVESQSEAESLLQKLKRGASFQTLARRHSRCPSKR
FT                   "
     MARRAAALHI LVESQSEAES LLQKLKRGAS FQTLARRHSR CPSKR                        45
//

If you have problems or comments...

PBIL Back to PBIL home page