(data stored in ACNUC7421 zone)

EMBL: CP001600.PE9

CP001600.PE9         Location/Qualifiers
FT   CDS             9102..9515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0009"
FT                   /product="Hsp20/alpha crystallin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67271"
FT                   /db_xref="GOA:C5BHD3"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD3"
FT                   /protein_id="ACR67271.1"
FT                   /translation="MRNFDLAPLYRSAIGFDRLFNLIESGQNNTNGGYPPYNVELVDDN
FT                   HYRISIAVAGFDEAELEIIYHVNSLIIKGSHLVSDKRRTYLYQGIAERNFERKFQLAEH
FT                   IHINEARLENGLLFIDLERIVPESQQARKIDIK"
     MRNFDLAPLY RSAIGFDRLF NLIESGQNNT NGGYPPYNVE LVDDNHYRIS IAVAGFDEAE        60
     LEIIYHVNSL IIKGSHLVSD KRRTYLYQGI AERNFERKFQ LAEHIHINEA RLENGLLFID       120
     LERIVPESQQ ARKIDIK                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page