(data stored in ACNUC7421 zone)

EMBL: CP001600.PE95

CP001600.PE95        Location/Qualifiers
FT   CDS             95887..97137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0098"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67358"
FT                   /db_xref="GOA:C5BBC3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC3"
FT                   /protein_id="ACR67358.1"
FT                   /translation="MSLARASLWTAGSTLIKIGAGLVVVKLLAVAFGPVGVGQAANFRQ
FT                   VITVLGVLSGAGIFNGITKYVAEYRQQPLRLRALLGTASTMILGFSLLLALIFTLGAAP
FT                   ISVALFGHDDYQAVIRLVALLQMGIACANYCLAVIKGYRDARGNALAVALGSLLGVAAY
FT                   TLSYFWGGYRGALAGLALVPAVATLPALWVLWRQRHIPWRYFRPSWDRPLAAGLGKFTL
FT                   MAVMTAVTMPVAYVMMRNQLAALDGWEAVGIWQGVSGISDAYLQFITASFSVYLLPTLA
FT                   GLRSRQAVGQEILRALRFVLPAVAAVSFMVWLLRDLVIWLLLSGKFSAMRDLFAWQLTG
FT                   DVFKVGAYVFGYLVIAKASLRFYLLCEISQFILLTLLSRFLIPQHGALGAAQAYMATYI
FT                   IYFLLCGSVFWIYRNRA"
     MSLARASLWT AGSTLIKIGA GLVVVKLLAV AFGPVGVGQA ANFRQVITVL GVLSGAGIFN        60
     GITKYVAEYR QQPLRLRALL GTASTMILGF SLLLALIFTL GAAPISVALF GHDDYQAVIR       120
     LVALLQMGIA CANYCLAVIK GYRDARGNAL AVALGSLLGV AAYTLSYFWG GYRGALAGLA       180
     LVPAVATLPA LWVLWRQRHI PWRYFRPSWD RPLAAGLGKF TLMAVMTAVT MPVAYVMMRN       240
     QLAALDGWEA VGIWQGVSGI SDAYLQFITA SFSVYLLPTL AGLRSRQAVG QEILRALRFV       300
     LPAVAAVSFM VWLLRDLVIW LLLSGKFSAM RDLFAWQLTG DVFKVGAYVF GYLVIAKASL       360
     RFYLLCEISQ FILLTLLSRF LIPQHGALGA AQAYMATYII YFLLCGSVFW IYRNRA           416
//

If you have problems or comments...

PBIL Back to PBIL home page