(data stored in ACNUC7421 zone)

EMBL: CP001600.PE97

CP001600.PE97        Location/Qualifiers
FT   CDS             98207..99595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0100"
FT                   /product="ECA biosynthesis protein WzyE, putative"
FT                   /note="ECA biosynthesis protein WzyE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67360"
FT                   /db_xref="GOA:C5BBC5"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC5"
FT                   /protein_id="ACR67360.1"
FT                   /translation="MTLMQFAGLTLVYFFSLLFVAFLTYKEFRRVRFNFNVFFSLLFLL
FT                   TFYFGFPLTCTLVFRFDVATVPAEEMLYALLSATAFYALYYVTYKTRLRSATSAPGSGS
FT                   AWLQLNRVEAQLTWILLALVALVTVTIFFLNNGFLLFKLHSYSQIFSSGVSGVALKRFF
FT                   YFFIPAMLVVYFLRQTQAAWLFFLVSTVIFGLLTYVIVGGTRANIIIAFALFLFIGIQR
FT                   GWITLWMLALAGVVGVVGMFWLALKRYGLAVSGDEAFYTFLYLTRDTFSPWENLALLLQ
FT                   HYTQIDFQGLAPIARDFYVFIPGWMWPDRPHLVLNSANYFTWQVLDNHSGLAISPTLIG
FT                   SLVVMGGAAFIPLGAIAVGLIIKWFDWLYTRGCTASNRYRGAVIQAFCFGAVFNMIVLA
FT                   REGLDAFVSRVVFFCIIFGCCLLLAKLLYWLFDAAGLIRARTAIAAPSVGEGSPTHKDR
FT                   NDGE"
     MTLMQFAGLT LVYFFSLLFV AFLTYKEFRR VRFNFNVFFS LLFLLTFYFG FPLTCTLVFR        60
     FDVATVPAEE MLYALLSATA FYALYYVTYK TRLRSATSAP GSGSAWLQLN RVEAQLTWIL       120
     LALVALVTVT IFFLNNGFLL FKLHSYSQIF SSGVSGVALK RFFYFFIPAM LVVYFLRQTQ       180
     AAWLFFLVST VIFGLLTYVI VGGTRANIII AFALFLFIGI QRGWITLWML ALAGVVGVVG       240
     MFWLALKRYG LAVSGDEAFY TFLYLTRDTF SPWENLALLL QHYTQIDFQG LAPIARDFYV       300
     FIPGWMWPDR PHLVLNSANY FTWQVLDNHS GLAISPTLIG SLVVMGGAAF IPLGAIAVGL       360
     IIKWFDWLYT RGCTASNRYR GAVIQAFCFG AVFNMIVLAR EGLDAFVSRV VFFCIIFGCC       420
     LLLAKLLYWL FDAAGLIRAR TAIAAPSVGE GSPTHKDRND GE                          462
//

If you have problems or comments...

PBIL Back to PBIL home page