(data stored in ACNUC7421 zone)

EMBL: CP001600.PE99

CP001600.PE99        Location/Qualifiers
FT   CDS             complement(101525..102724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0107"
FT                   /product="HemY protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67362"
FT                   /db_xref="GOA:C5BBC7"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC7"
FT                   /protein_id="ACR67362.1"
FT                   /translation="MLKVLLLFIILIAGIVLGPMLAGHQGYVLIQTDSYNIETSVTSLV
FT                   IMLILLMLALFALEWLLRRLLRTGARTRGWFIGRKRTRARRQTCAGLLKLTEGDYGQVE
FT                   KLLARNADHADQPLVNYLLAAEAAQQRGDELRANQYLERAAEVAGSDPLPVDITRVRLQ
FT                   LARGENHAARHGVDALLNYAPRHPEVLRLAEQAYLRTDAFGPLLEILPALAKQGLHSDD
FT                   DIEKLQIRAYIGLMDQAMANGGSEELKQWWKAQRRTTRHETVLQVALAEHLIECDDHGA
FT                   AQQIVVDGLKRRFDERLVQLMPQLKSGNPEQLEKLLQQQIRQHGASALLNSTLGQLLMR
FT                   HGEWQQAAEVLRAALKQRPDPYDYAWLADTLDKLHRPEEAAQMRRDGLLLTLHQDQPTA
FT                   "
     MLKVLLLFII LIAGIVLGPM LAGHQGYVLI QTDSYNIETS VTSLVIMLIL LMLALFALEW        60
     LLRRLLRTGA RTRGWFIGRK RTRARRQTCA GLLKLTEGDY GQVEKLLARN ADHADQPLVN       120
     YLLAAEAAQQ RGDELRANQY LERAAEVAGS DPLPVDITRV RLQLARGENH AARHGVDALL       180
     NYAPRHPEVL RLAEQAYLRT DAFGPLLEIL PALAKQGLHS DDDIEKLQIR AYIGLMDQAM       240
     ANGGSEELKQ WWKAQRRTTR HETVLQVALA EHLIECDDHG AAQQIVVDGL KRRFDERLVQ       300
     LMPQLKSGNP EQLEKLLQQQ IRQHGASALL NSTLGQLLMR HGEWQQAAEV LRAALKQRPD       360
     PYDYAWLADT LDKLHRPEEA AQMRRDGLLL TLHQDQPTA                              399
//

If you have problems or comments...

PBIL Back to PBIL home page