(data stored in ACNUC30630 zone)

EMBL: CP001606.PE111

CP001606.PE111       Location/Qualifiers
FT   CDS             complement(130832..131275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0115"
FT                   /product="carboxymuconolactone decarboxylase"
FT                   /note="COG1917 Uncharacterized conserved protein, contains
FT                   double-stranded beta-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47076"
FT                   /protein_id="ACS47076.1"
FT                   /translation="MNNYPIPVGVPTAYAQSLMFPVGEPNDAYAQYFTGRSWLAPVSGE
FT                   QVSMANVTFEPGCINHWHIHHATKGGGQMLICVGGRGYAQIEGQEPIAMTPGTVVHIPA
FT                   NTKHWHGAAPGSWFSHIAIDVPGEGKSNDWLEPVDEAFYRSLK"
     MNNYPIPVGV PTAYAQSLMF PVGEPNDAYA QYFTGRSWLA PVSGEQVSMA NVTFEPGCIN        60
     HWHIHHATKG GGQMLICVGG RGYAQIEGQE PIAMTPGTVV HIPANTKHWH GAAPGSWFSH       120
     IAIDVPGEGK SNDWLEPVDE AFYRSLK                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page