(data stored in ACNUC30630 zone)

EMBL: CP001606.PE157

CP001606.PE157       Location/Qualifiers
FT   CDS             184023..184724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0161"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47122"
FT                   /protein_id="ACS47122.1"
FT                   /translation="MAYIEFNDVVKEYPAGSSSIRALDGASFAADEGELSVILGQSGAG
FT                   KTTALNILGGMDTATSGRVIVGGRDITDLNHHDLVTYRRNDIGFVFQFYNLIPNLTALE
FT                   NVELASQICTDHFDPAQTLAKVGLADRLGNFPAQLSGGEQQRVSIARALAKKPKLLLCD
FT                   EPTGALDYETGKEVLQLLQDICRTERMTVLIVTHNSALAPMAHKVIRFRSGKVTSQETN
FT                   EHPVPISQIEW"
     MAYIEFNDVV KEYPAGSSSI RALDGASFAA DEGELSVILG QSGAGKTTAL NILGGMDTAT        60
     SGRVIVGGRD ITDLNHHDLV TYRRNDIGFV FQFYNLIPNL TALENVELAS QICTDHFDPA       120
     QTLAKVGLAD RLGNFPAQLS GGEQQRVSIA RALAKKPKLL LCDEPTGALD YETGKEVLQL       180
     LQDICRTERM TVLIVTHNSA LAPMAHKVIR FRSGKVTSQE TNEHPVPISQ IEW              233
//

If you have problems or comments...

PBIL Back to PBIL home page