(data stored in ACNUC30630 zone)

EMBL: CP001606.PE16

CP001606.PE16        Location/Qualifiers
FT   CDS             19968..20732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0018"
FT                   /product="hypothetical protein"
FT                   /note="COG1451 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46981"
FT                   /protein_id="ACS46981.1"
FT                   /translation="MVMPFNSVPRARSISRRAQFDRSTRAREVLNVDGLQVNVLRKKNR
FT                   NMYLRVKPPYGAIEVTAPVRMPQHTIVEFVRERRSWVDEALHKMAQARSRTFASPDLDP
FT                   DVGGSRTTVLRDARDPGSPRMETPHETSSFTWNEEYVERARRSIEQQLPDLLSKWTPIV
FT                   GKSPTKITLRTMTSRWGSCTPKTGRIRLNLQLGLMDPQFLEYVLVHELTHLWESGHGRT
FT                   FQERMSLVLPNWKELRRELNRCTIFDVPQSRG"
     MVMPFNSVPR ARSISRRAQF DRSTRAREVL NVDGLQVNVL RKKNRNMYLR VKPPYGAIEV        60
     TAPVRMPQHT IVEFVRERRS WVDEALHKMA QARSRTFASP DLDPDVGGSR TTVLRDARDP       120
     GSPRMETPHE TSSFTWNEEY VERARRSIEQ QLPDLLSKWT PIVGKSPTKI TLRTMTSRWG       180
     SCTPKTGRIR LNLQLGLMDP QFLEYVLVHE LTHLWESGHG RTFQERMSLV LPNWKELRRE       240
     LNRCTIFDVP QSRG                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page