(data stored in ACNUC30630 zone)

EMBL: CP001606.PE171

CP001606.PE171       Location/Qualifiers
FT   CDS             complement(202039..203298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0175"
FT                   /product="branched-chain amino acid transport system
FT                   substrate-binding protein"
FT                   /note="COG0683 ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47136"
FT                   /protein_id="ACS47136.1"
FT                   /translation="MNKPNRKTWRTTATAMAATAVLTLSGCGTGTADSSANAAEDTFVA
FT                   GGLFPLTGTAAYLGPSNVSTMKLAEQDIDEAGGVLGNKISTITADTSDAEHADQNATAV
FT                   QSVLSKNPSVVIGPPLSSVVKNTYKQVTTSKIPMISPGATSTAFSGLDDYFFRTIPPDT
FT                   VQGVVMGDLIAQDGIKNLAIAVFNDEYGISLRAEVLKTLKEGGVNVVYGETETFDPAEN
FT                   NFSSIATNIKATNPDAVLVIAADQTIPLVKELAAKGIDTHKLYMPDSNMVDHSKDFTSG
FT                   LLKGSKGTIPGAHPTSEFQNALKTIAPDTTIYTYNTETYDAMVLAALAAEKGGAADSET
FT                   VQKNLMAVSGTTKGEKCESYEDCVALMKSGKEIQYVGKTSIGVFNNAHDPSTASIGIYE
FT                   YDDSNVPVFLDSQEGAVPQN"
     MNKPNRKTWR TTATAMAATA VLTLSGCGTG TADSSANAAE DTFVAGGLFP LTGTAAYLGP        60
     SNVSTMKLAE QDIDEAGGVL GNKISTITAD TSDAEHADQN ATAVQSVLSK NPSVVIGPPL       120
     SSVVKNTYKQ VTTSKIPMIS PGATSTAFSG LDDYFFRTIP PDTVQGVVMG DLIAQDGIKN       180
     LAIAVFNDEY GISLRAEVLK TLKEGGVNVV YGETETFDPA ENNFSSIATN IKATNPDAVL       240
     VIAADQTIPL VKELAAKGID THKLYMPDSN MVDHSKDFTS GLLKGSKGTI PGAHPTSEFQ       300
     NALKTIAPDT TIYTYNTETY DAMVLAALAA EKGGAADSET VQKNLMAVSG TTKGEKCESY       360
     EDCVALMKSG KEIQYVGKTS IGVFNNAHDP STASIGIYEY DDSNVPVFLD SQEGAVPQN        419
//

If you have problems or comments...

PBIL Back to PBIL home page