(data stored in ACNUC30630 zone)

EMBL: CP001606.PE177

CP001606.PE177       Location/Qualifiers
FT   CDS             211240..212727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0181"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47142"
FT                   /protein_id="ACS47142.1"
FT                   /translation="MNGTRCALDGCSFRYASDESADGVERGVHAIDHVSLQARAGEVVM
FT                   LVGRSGCGKTTVTRLLNGLAPEYFRGSLHGEARVGGLHAGVAAVEDYATEVGSVFQNPK
FT                   TQYFHANSTDELAFPCENAGMEPSEIRRRIRERLRAFDVEHLHDRNIVDCSGGQQQQLA
FT                   VVAATMLDPGVLVLDEPTSNLDAEAMERLRNMVKRLKRDGIAIVIAEHRLAWVADLADR
FT                   YVVFDAGRVVGEYTAEQFHALPESQRRAWGLRALELSGPRGQVERIAQRAEPSGEKPVI
FT                   ATRGLKVGYERRRLFGRTKRGFVREVGDVNLFAGQIVGLIGRNGAGKSTFVKTVCGLVE
FT                   PVAGEILVDGRAAKPGRLSALCAMVMQDVNYQLFASSVREEMLLEAMQHVRTAEDAQRV
FT                   RERADGILRQLGLLDFAERHPMTLSGGQKQRLAIGVALMGEKRVVVLDEPTSGLDRHHM
FT                   LQVGALMRDLADRGVCVLVVTHDDELAAEVCDRIVRF"
     MNGTRCALDG CSFRYASDES ADGVERGVHA IDHVSLQARA GEVVMLVGRS GCGKTTVTRL        60
     LNGLAPEYFR GSLHGEARVG GLHAGVAAVE DYATEVGSVF QNPKTQYFHA NSTDELAFPC       120
     ENAGMEPSEI RRRIRERLRA FDVEHLHDRN IVDCSGGQQQ QLAVVAATML DPGVLVLDEP       180
     TSNLDAEAME RLRNMVKRLK RDGIAIVIAE HRLAWVADLA DRYVVFDAGR VVGEYTAEQF       240
     HALPESQRRA WGLRALELSG PRGQVERIAQ RAEPSGEKPV IATRGLKVGY ERRRLFGRTK       300
     RGFVREVGDV NLFAGQIVGL IGRNGAGKST FVKTVCGLVE PVAGEILVDG RAAKPGRLSA       360
     LCAMVMQDVN YQLFASSVRE EMLLEAMQHV RTAEDAQRVR ERADGILRQL GLLDFAERHP       420
     MTLSGGQKQR LAIGVALMGE KRVVVLDEPT SGLDRHHMLQ VGALMRDLAD RGVCVLVVTH       480
     DDELAAEVCD RIVRF                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page