(data stored in ACNUC30630 zone)

EMBL: CP001606.PE179

CP001606.PE179       Location/Qualifiers
FT   CDS             complement(214556..215437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0183"
FT                   /product="hypothetical protein"
FT                   /note="COG4667 Predicted esterase of the alpha-beta
FT                   hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47144"
FT                   /protein_id="ACS47144.1"
FT                   /translation="MAVQQTTQPTRPTRREKVGVIDVGGGLRSAYSTGVLDYCLDNGIH
FT                   FDYGLGVSAGAANITSYLAGQRGRPLRFYTKYCPRPEYMSLGNFLRDGSYLGLDYIYGT
FT                   LMNEDGEDPLDYDALVAGGVPYRITVTDALSGMPKYLGPESMSRNHYDALKATACLPVL
FT                   DKPYPLDGRPYFDGTISDPIPFRQAFADGCTKLVVILTRPRDFYRNPDKDIASSMMLAV
FT                   RYPEAARALANRAHTYNVELNMCKRLEAQGKVRIIAPKSIDGVSTLTKDPDKIQNLYNR
FT                   AYNDATALRNFL"
     MAVQQTTQPT RPTRREKVGV IDVGGGLRSA YSTGVLDYCL DNGIHFDYGL GVSAGAANIT        60
     SYLAGQRGRP LRFYTKYCPR PEYMSLGNFL RDGSYLGLDY IYGTLMNEDG EDPLDYDALV       120
     AGGVPYRITV TDALSGMPKY LGPESMSRNH YDALKATACL PVLDKPYPLD GRPYFDGTIS       180
     DPIPFRQAFA DGCTKLVVIL TRPRDFYRNP DKDIASSMML AVRYPEAARA LANRAHTYNV       240
     ELNMCKRLEA QGKVRIIAPK SIDGVSTLTK DPDKIQNLYN RAYNDATALR NFL              293
//

If you have problems or comments...

PBIL Back to PBIL home page