(data stored in ACNUC30630 zone)

EMBL: CP001606.PE180

CP001606.PE180       Location/Qualifiers
FT   CDS             215573..216340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0184"
FT                   /product="hypothetical protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47145"
FT                   /protein_id="ACS47145.1"
FT                   /translation="MLVPMNDVNPYAAAAHIEVLPLTPTRQSIERALVEWMTQTGRPAS
FT                   DLSVSALCKKAFVARSTFYANYRHMGQVYESVENRLLRQLFECAVPMRVRADGTDETMR
FT                   SFNAFVKVLHAHENEFRLVLVRQPSSRFVALWKQSLEYHVWHRLFETERGGAAAVDAVA
FT                   EWGDGAAPGTSNGGSATSQEGLPAGTDADATNRNELPVRQGPATVNRALVFDMAATAFI
FT                   AGVTFWLRTPQAVSLPEIRASVVKLVNNIDEIW"
     MLVPMNDVNP YAAAAHIEVL PLTPTRQSIE RALVEWMTQT GRPASDLSVS ALCKKAFVAR        60
     STFYANYRHM GQVYESVENR LLRQLFECAV PMRVRADGTD ETMRSFNAFV KVLHAHENEF       120
     RLVLVRQPSS RFVALWKQSL EYHVWHRLFE TERGGAAAVD AVAEWGDGAA PGTSNGGSAT       180
     SQEGLPAGTD ADATNRNELP VRQGPATVNR ALVFDMAATA FIAGVTFWLR TPQAVSLPEI       240
     RASVVKLVNN IDEIW                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page