(data stored in ACNUC30630 zone)

EMBL: CP001606.PE19

CP001606.PE19        Location/Qualifiers
FT   CDS             22644..22898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46984"
FT                   /protein_id="ACS46984.1"
FT                   /translation="MPRVVPQLESPVHRAFRSPREGIGTQIAQDGFDRVIDHFLQSTMA
FT                   LHAIEEADFVILRFADARMNSDIHIQPREELLWIYACDE"
     MPRVVPQLES PVHRAFRSPR EGIGTQIAQD GFDRVIDHFL QSTMALHAIE EADFVILRFA        60
     DARMNSDIHI QPREELLWIY ACDE                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page