(data stored in ACNUC30630 zone)

EMBL: CP001606.PE199

CP001606.PE199       Location/Qualifiers
FT   CDS             240138..241151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47164"
FT                   /protein_id="ACS47164.1"
FT                   /translation="MRMRDARARRPWQAESARRVPAYQPVHAMAEPACSPQLSPPARRT
FT                   HAGAQHARMPVCATQAPCENVITLSGASGGAGTTTLAAMLTRELAKRENECAIVDADVR
FT                   AGGGGLDVLLGIEHESGSRWHDIHAPLGELDGEALRRRLPHWDGVGVLAYNCWVQEEPA
FT                   WFEMQAALQSLAQVSDAVVVDAGHGLEIEHVPALVEASHIVVAELTVLGLARAKAHIEW
FT                   LRRNGERNMARAQEPPRPGEEWKPIVGVPGRVIGVLCVEPPAVAKGRGAVSLEEARKYL
FT                   QMEHMECELMGPVRSDARLCGDILEGLGIRRVHRRNARVLGDVAEMVERACGIGGR"
     MRMRDARARR PWQAESARRV PAYQPVHAMA EPACSPQLSP PARRTHAGAQ HARMPVCATQ        60
     APCENVITLS GASGGAGTTT LAAMLTRELA KRENECAIVD ADVRAGGGGL DVLLGIEHES       120
     GSRWHDIHAP LGELDGEALR RRLPHWDGVG VLAYNCWVQE EPAWFEMQAA LQSLAQVSDA       180
     VVVDAGHGLE IEHVPALVEA SHIVVAELTV LGLARAKAHI EWLRRNGERN MARAQEPPRP       240
     GEEWKPIVGV PGRVIGVLCV EPPAVAKGRG AVSLEEARKY LQMEHMECEL MGPVRSDARL       300
     CGDILEGLGI RRVHRRNARV LGDVAEMVER ACGIGGR                                337
//

If you have problems or comments...

PBIL Back to PBIL home page