(data stored in ACNUC30630 zone)

EMBL: CP001606.PE203

CP001606.PE203       Location/Qualifiers
FT   CDS             243907..244182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47168"
FT                   /protein_id="ACS47168.1"
FT                   /translation="MEHNEVILFEHRRHGVGERINAASDRLLRAQVGLEARWRALMSQP
FT                   EEGAATAEYAVVLVAATGFAAVLVALMKSDTVKTLLTNIVKKALNV"
     MEHNEVILFE HRRHGVGERI NAASDRLLRA QVGLEARWRA LMSQPEEGAA TAEYAVVLVA        60
     ATGFAAVLVA LMKSDTVKTL LTNIVKKALN V                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page