(data stored in ACNUC30630 zone)

EMBL: CP001606.PE204

CP001606.PE204       Location/Qualifiers
FT   CDS             244187..244570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47169"
FT                   /protein_id="ACS47169.1"
FT                   /translation="MGGHAFGQALRRLQCDDEGAATAEFAVVLPVIVMLAALMLYLGRA
FT                   SVVSVGCQDAAANAARALMVQGSGSGSQAMAQAAAGDGARIEVRPAGIGFEVIAHCAVV
FT                   ADPWGIVPRMVTGRAHGIWQERL"
     MGGHAFGQAL RRLQCDDEGA ATAEFAVVLP VIVMLAALML YLGRASVVSV GCQDAAANAA        60
     RALMVQGSGS GSQAMAQAAA GDGARIEVRP AGIGFEVIAH CAVVADPWGI VPRMVTGRAH       120
     GIWQERL                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page