(data stored in ACNUC30630 zone)

EMBL: CP001606.PE205

CP001606.PE205       Location/Qualifiers
FT   CDS             244617..245057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47170"
FT                   /protein_id="ACS47170.1"
FT                   /translation="MSAAARRVPTRSAPCIPHGLRAQDAGNASPSAVGIVLVVAVLLCT
FT                   IAAGARIAMARAQARTAADMSALAAADAYWNEAAADPCGIGSAVARNNAGAVESCEVID
FT                   MDVAMEVSTATGVPFVERVSARARAGPRRCDEVDATRGASQP"
     MSAAARRVPT RSAPCIPHGL RAQDAGNASP SAVGIVLVVA VLLCTIAAGA RIAMARAQAR        60
     TAADMSALAA ADAYWNEAAA DPCGIGSAVA RNNAGAVESC EVIDMDVAME VSTATGVPFV       120
     ERVSARARAG PRRCDEVDAT RGASQP                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page