(data stored in ACNUC30630 zone)

EMBL: CP001606.PE219

CP001606.PE219       Location/Qualifiers
FT   CDS             265873..266577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0224"
FT                   /product="hypothetical protein"
FT                   /note="COG1881 Phospholipid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47184"
FT                   /protein_id="ACS47184.1"
FT                   /translation="MAFGGFRGNRQSVIWKWQFTRKCLRKLPFNARVLGVNKKRTGDTV
FT                   RDTGTMLVSADFNTIPEQYAKNAPDDARVDGVPCVSFPFYIDHLNPAAKYLHWEFSDPD
FT                   SIPVCGFEWIHWTMANLPVAALMFDPSDAHALQIPPDFSRRVTAMIPEAVQGRNSQASP
FT                   LYGQDQRNLQLVAHYTGPQPPDKDHGYVLQIWGTTSPIAGLEQGFWLNEMLHGLEHSQV
FT                   VDGGGITLIGKC"
     MAFGGFRGNR QSVIWKWQFT RKCLRKLPFN ARVLGVNKKR TGDTVRDTGT MLVSADFNTI        60
     PEQYAKNAPD DARVDGVPCV SFPFYIDHLN PAAKYLHWEF SDPDSIPVCG FEWIHWTMAN       120
     LPVAALMFDP SDAHALQIPP DFSRRVTAMI PEAVQGRNSQ ASPLYGQDQR NLQLVAHYTG       180
     PQPPDKDHGY VLQIWGTTSP IAGLEQGFWL NEMLHGLEHS QVVDGGGITL IGKC             234
//

If you have problems or comments...

PBIL Back to PBIL home page