(data stored in ACNUC30630 zone)

EMBL: CP001606.PE222

CP001606.PE222       Location/Qualifiers
FT   CDS             271359..272528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0227"
FT                   /product="hypothetical protein"
FT                   /note="COG1373 Predicted ATPase (AAA+ superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47187"
FT                   /protein_id="ACS47187.1"
FT                   /translation="MPLIPRELEPMLLERARAYPAVTLTGPRQSGKSTLVREAFPDYDY
FT                   VSLEDIDMRELAHDDPRSFLQRYSNHVILDEVQRVPELFSYMQRVMDERNEPGQFILSG
FT                   SQNFLLLNSISQSLAGRVAILHLLPLSYTELTHAGETPSNDEFVFRGGYPRLYSSLATP
FT                   ADFYPGYVATYIDRDVRAELGVKKIDSFNRFLTLAALRIGEVMNVSHLADEADVDSATI
FT                   RNWLSILNASFIAFQLQPYYRNYGKRLVKSAKLYFYDTGLAANLLGIESADQLFASQCR
FT                   GALFENAVVLEIVKQYQAQGKEPKLYYWRDSGQKEVDLIIERGGNPYFVIEIKSSATYR
FT                   PKYFETLDDIAEAMGVPTERRFVVYGGEETIPTRHGTVIGLRDIGRLVR"
     MPLIPRELEP MLLERARAYP AVTLTGPRQS GKSTLVREAF PDYDYVSLED IDMRELAHDD        60
     PRSFLQRYSN HVILDEVQRV PELFSYMQRV MDERNEPGQF ILSGSQNFLL LNSISQSLAG       120
     RVAILHLLPL SYTELTHAGE TPSNDEFVFR GGYPRLYSSL ATPADFYPGY VATYIDRDVR       180
     AELGVKKIDS FNRFLTLAAL RIGEVMNVSH LADEADVDSA TIRNWLSILN ASFIAFQLQP       240
     YYRNYGKRLV KSAKLYFYDT GLAANLLGIE SADQLFASQC RGALFENAVV LEIVKQYQAQ       300
     GKEPKLYYWR DSGQKEVDLI IERGGNPYFV IEIKSSATYR PKYFETLDDI AEAMGVPTER       360
     RFVVYGGEET IPTRHGTVIG LRDIGRLVR                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page