(data stored in ACNUC30630 zone)

EMBL: CP001606.PE226

CP001606.PE226       Location/Qualifiers
FT   CDS             complement(276243..276800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0231"
FT                   /product="hypothetical protein"
FT                   /note="COG2246 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47191"
FT                   /protein_id="ACS47191.1"
FT                   /translation="MRKLIEQILKFGVVGAIAFIIDWGILNLLVGVFHMHNVIAGTISF
FT                   FISLVFNYFASMKYVFKHRPDMARWMEMAIFLFSSLVGLFLNALIIWLSTYGMNRDAFI
FT                   TQHAEYLLRTNMGKLVATVIVAIWNFIIRKWLLDDTHTNAMNRLRRKGNVLSEEELEAK
FT                   WEKSFSHRLGMWSIEHTPKGWE"
     MRKLIEQILK FGVVGAIAFI IDWGILNLLV GVFHMHNVIA GTISFFISLV FNYFASMKYV        60
     FKHRPDMARW MEMAIFLFSS LVGLFLNALI IWLSTYGMNR DAFITQHAEY LLRTNMGKLV       120
     ATVIVAIWNF IIRKWLLDDT HTNAMNRLRR KGNVLSEEEL EAKWEKSFSH RLGMWSIEHT       180
     PKGWE                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page