(data stored in ACNUC30630 zone)

EMBL: CP001606.PE232

CP001606.PE232       Location/Qualifiers
FT   CDS             285048..286304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0239"
FT                   /product="hypothetical protein"
FT                   /note="COG1409 Predicted phosphohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47197"
FT                   /protein_id="ACS47197.1"
FT                   /translation="MSEAKPVSVSRRLGRLQFHKSGKFRVLQLADVQDGPKISKDTIAL
FT                   ITAAIRDARPDLVVFSGNQIAGYDPAFAATFTKRRWKTAVGAAPKSADLAHTRELVRGQ
FT                   IEQMVQPMVDAGVPWAVTYGNHDFQCGLTNAELDGIFREFPLCVNPSTRAKFGAETWSR
FT                   ALPKERVIASGEPGTFSMPVCDESGNTVFGIVLVDSGDYSETGGYGAPSQTALRFLRTV
FT                   PQWFGEGVESIVFQHMPLPQYYRVLKPVPRTTDRSVEGYRNYSGSYFVLDDAKTERGGY
FT                   LGEGVSCPDLDSGEFDILRDSHAYFAVAAGHDHRNAFAGEYAGVQMIATPTCGFDSYGP
FT                   IPERRAARLFEFDERHPFSPRTQLLQFGELVGKPSSKKAYVYGMSSASKPKSEGVNLLH
FT                   KPSTVSRLWHSVGNWLFNH"
     MSEAKPVSVS RRLGRLQFHK SGKFRVLQLA DVQDGPKISK DTIALITAAI RDARPDLVVF        60
     SGNQIAGYDP AFAATFTKRR WKTAVGAAPK SADLAHTREL VRGQIEQMVQ PMVDAGVPWA       120
     VTYGNHDFQC GLTNAELDGI FREFPLCVNP STRAKFGAET WSRALPKERV IASGEPGTFS       180
     MPVCDESGNT VFGIVLVDSG DYSETGGYGA PSQTALRFLR TVPQWFGEGV ESIVFQHMPL       240
     PQYYRVLKPV PRTTDRSVEG YRNYSGSYFV LDDAKTERGG YLGEGVSCPD LDSGEFDILR       300
     DSHAYFAVAA GHDHRNAFAG EYAGVQMIAT PTCGFDSYGP IPERRAARLF EFDERHPFSP       360
     RTQLLQFGEL VGKPSSKKAY VYGMSSASKP KSEGVNLLHK PSTVSRLWHS VGNWLFNH         418
//

If you have problems or comments...

PBIL Back to PBIL home page