(data stored in ACNUC30630 zone)

EMBL: CP001606.PE234

CP001606.PE234       Location/Qualifiers
FT   CDS             288190..289587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0241"
FT                   /product="isopropylmalate isomerase large subunit"
FT                   /note="COG0065 3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47199"
FT                   /protein_id="ACS47199.1"
FT                   /translation="MTLAEKVWADHLVRKGSDGAPDLLYIDLMLMHEVTSPQAFEGLRL
FT                   AGRTPRHLDQLIATEDHNTPTVDIDKPNPDETSATQLTTLEKNCREFGVRLHPLGDADQ
FT                   GIVHAFAPMLGLTQPGMTIVCGDSHTSTHGAFGALAFGIGTSEVEHVMATQTLSLKPFK
FT                   TMAINIEGDLPAGVSAKDIILAIIAKIGTGGGQGYVLEYRGRAIEQLSMDARMTICNMS
FT                   IEAGARAGMIAPDETTFAYLKGRPHAPKGEMWDQAVEYWKTLRTDDDAVFDAEVTLRAE
FT                   DLEPFVTWGTNPGQGVAISGVVPAPDDFADATERSAAERALDYMGLEPGTPIRDIPVDT
FT                   VFIGSCTNGRIEDLRIAAEIMKGHKKADSIHRVLVVPASSRIRLQAEREGLDRIFKDFG
FT                   AEWRNAGCSMCLGMNPDKLVAHERSISTSNRNFEGRQGKGSRTHLASPAVAAATAIRGT
FT                   ISTPADL"
     MTLAEKVWAD HLVRKGSDGA PDLLYIDLML MHEVTSPQAF EGLRLAGRTP RHLDQLIATE        60
     DHNTPTVDID KPNPDETSAT QLTTLEKNCR EFGVRLHPLG DADQGIVHAF APMLGLTQPG       120
     MTIVCGDSHT STHGAFGALA FGIGTSEVEH VMATQTLSLK PFKTMAINIE GDLPAGVSAK       180
     DIILAIIAKI GTGGGQGYVL EYRGRAIEQL SMDARMTICN MSIEAGARAG MIAPDETTFA       240
     YLKGRPHAPK GEMWDQAVEY WKTLRTDDDA VFDAEVTLRA EDLEPFVTWG TNPGQGVAIS       300
     GVVPAPDDFA DATERSAAER ALDYMGLEPG TPIRDIPVDT VFIGSCTNGR IEDLRIAAEI       360
     MKGHKKADSI HRVLVVPASS RIRLQAEREG LDRIFKDFGA EWRNAGCSMC LGMNPDKLVA       420
     HERSISTSNR NFEGRQGKGS RTHLASPAVA AATAIRGTIS TPADL                       465
//

If you have problems or comments...

PBIL Back to PBIL home page