(data stored in ACNUC30630 zone)

EMBL: CP001606.PE24

CP001606.PE24        Location/Qualifiers
FT   CDS             29241..29954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46989"
FT                   /protein_id="ACS46989.1"
FT                   /translation="MHAPYLLAACVLMCGFIDKTFIYIIKLADFYLLEKVIAMRQWRGI
FT                   VSVIAAMAMIGGFAGCGQSQEQAGFSKSPQSSQTATGGASGEIGNMESEHHILPSSDVE
FT                   ELELRLESIGESTATGNLTLLGELHPTASYTERDGGRGMPSLQNQDELTFSDCKSYMLS
FT                   VLCMGEGSVSIEWTLGTQSEQRNLECAPKIAETALGMSNVNAKSSTVKIVAEEGSKAEI
FT                   AYRLDEIGKPGVVVD"
     MHAPYLLAAC VLMCGFIDKT FIYIIKLADF YLLEKVIAMR QWRGIVSVIA AMAMIGGFAG        60
     CGQSQEQAGF SKSPQSSQTA TGGASGEIGN MESEHHILPS SDVEELELRL ESIGESTATG       120
     NLTLLGELHP TASYTERDGG RGMPSLQNQD ELTFSDCKSY MLSVLCMGEG SVSIEWTLGT       180
     QSEQRNLECA PKIAETALGM SNVNAKSSTV KIVAEEGSKA EIAYRLDEIG KPGVVVD          237
//

If you have problems or comments...

PBIL Back to PBIL home page