(data stored in ACNUC30630 zone)

EMBL: CP001606.PE244

CP001606.PE244       Location/Qualifiers
FT   CDS             complement(301754..302569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0251"
FT                   /product="hypothetical protein"
FT                   /note="COG0668 Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47209"
FT                   /protein_id="ACS47209.1"
FT                   /translation="MLDWLKANSGRIIFLAIVIALAFVVTRLLSRGLRKVLEHNKIPQA
FT                   SIFINIARVLVWVVALTIVLHPVFGVSPASLFTALGIGGLAISLGLKDSIANTIGGFTL
FT                   MFSHVIQPGDTVSINDTTGVVQDINWRQTVVRERNGNLMMIPNSVLNTTALEKLDPANE
FT                   CLVTIPFTAKPDVDTAKLAQDLLSTVNTHARSLMNPKYKAVVRYTGFTSDGVSGNIVAY
FT                   AKHGVALTALSDAIARAVHSSKLNLNFTASSLVGIDESGALTGKSTSRS"
     MLDWLKANSG RIIFLAIVIA LAFVVTRLLS RGLRKVLEHN KIPQASIFIN IARVLVWVVA        60
     LTIVLHPVFG VSPASLFTAL GIGGLAISLG LKDSIANTIG GFTLMFSHVI QPGDTVSIND       120
     TTGVVQDINW RQTVVRERNG NLMMIPNSVL NTTALEKLDP ANECLVTIPF TAKPDVDTAK       180
     LAQDLLSTVN THARSLMNPK YKAVVRYTGF TSDGVSGNIV AYAKHGVALT ALSDAIARAV       240
     HSSKLNLNFT ASSLVGIDES GALTGKSTSR S                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page