(data stored in ACNUC30630 zone)

EMBL: CP001606.PE278

CP001606.PE278       Location/Qualifiers
FT   CDS             352166..352786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47243"
FT                   /protein_id="ACS47243.1"
FT                   /translation="MRYLAGIWRLAIAALCFIGTSPAWHAVSLWAFLMYQIGFIAGIVM
FT                   LWSGCASILRGVQPPALLRGFVLTYAFSLAAVHFFVTPAAEFGVPAQQVIPLSAQVLAL
FT                   IVVGMLAVDFFAFEPHRAFKPVYPLVWLVYLPLYAAFAIARAYWFPHSGPTANAYPYDY
FT                   LIITQFTWGGAGVACLKIVAIYLAVGVVLCLFDRALPAKSAAE"
     MRYLAGIWRL AIAALCFIGT SPAWHAVSLW AFLMYQIGFI AGIVMLWSGC ASILRGVQPP        60
     ALLRGFVLTY AFSLAAVHFF VTPAAEFGVP AQQVIPLSAQ VLALIVVGML AVDFFAFEPH       120
     RAFKPVYPLV WLVYLPLYAA FAIARAYWFP HSGPTANAYP YDYLIITQFT WGGAGVACLK       180
     IVAIYLAVGV VLCLFDRALP AKSAAE                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page