(data stored in ACNUC30630 zone)

EMBL: CP001606.PE290

CP001606.PE290       Location/Qualifiers
FT   CDS             complement(365643..366584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0299"
FT                   /product="hypothetical protein"
FT                   /note="COG0679 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47255"
FT                   /protein_id="ACS47255.1"
FT                   /translation="MGGLISAMEGFCVIGIVIAAGYAAARLQIGGAQAQYVFNRLSFFI
FT                   ASPCLMFAILAQENITHLFDSTIIVAFCSAVGVGLVFLVLNRLFFHLKAPDATIGVLNS
FT                   LYLNSNNIGLPIATYILGNPALVAPILVMQQALFTPVGLTVLDVTTKGKFSVKQVLKQP
FT                   LHQPLLIGTVLGIIVSVVSSKVGHFIVPNFLFDPIDMIGDSAVPMILMAFGMSLHGTKP
FT                   MQNKSNLPAIWTVAALKNIVMPLIAFGIAFAMGFRGPTLYGCVVLAALPTGQNVYNYAA
FT                   RYNVGMTFARDGILISTMTSPIVIAIIAALLS"
     MGGLISAMEG FCVIGIVIAA GYAAARLQIG GAQAQYVFNR LSFFIASPCL MFAILAQENI        60
     THLFDSTIIV AFCSAVGVGL VFLVLNRLFF HLKAPDATIG VLNSLYLNSN NIGLPIATYI       120
     LGNPALVAPI LVMQQALFTP VGLTVLDVTT KGKFSVKQVL KQPLHQPLLI GTVLGIIVSV       180
     VSSKVGHFIV PNFLFDPIDM IGDSAVPMIL MAFGMSLHGT KPMQNKSNLP AIWTVAALKN       240
     IVMPLIAFGI AFAMGFRGPT LYGCVVLAAL PTGQNVYNYA ARYNVGMTFA RDGILISTMT       300
     SPIVIAIIAA LLS                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page