(data stored in ACNUC30630 zone)

EMBL: CP001606.PE302

CP001606.PE302       Location/Qualifiers
FT   CDS             380797..381588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0312"
FT                   /product="hypothetical protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47267"
FT                   /protein_id="ACS47267.1"
FT                   /translation="MTKFEHADILDLLGGDIDDNAVMRLVFECLISGIDDDRVVSLMNL
FT                   IGWRGSFSCFALGGTPADSMGATFTQISSAVRDFGGSHAIFGMYGRFVIACIELEAAVS
FT                   PEIVCTAALPAFAQSEAVYLSPVREGVPGASHAVRETLFSLQAAPSLSTQSRPLRADEL
FT                   LPERALLGDEVAREELYRNVYLVLHGDNEDDPSYITVSTFLRHGGSLEATAKELNVHPN
FT                   TVRYRLKKAAETTGWDATNPRDAFVLNTAIALGRMREAGVR"
     MTKFEHADIL DLLGGDIDDN AVMRLVFECL ISGIDDDRVV SLMNLIGWRG SFSCFALGGT        60
     PADSMGATFT QISSAVRDFG GSHAIFGMYG RFVIACIELE AAVSPEIVCT AALPAFAQSE       120
     AVYLSPVREG VPGASHAVRE TLFSLQAAPS LSTQSRPLRA DELLPERALL GDEVAREELY       180
     RNVYLVLHGD NEDDPSYITV STFLRHGGSL EATAKELNVH PNTVRYRLKK AAETTGWDAT       240
     NPRDAFVLNT AIALGRMREA GVR                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page