(data stored in ACNUC30630 zone)

EMBL: CP001606.PE305

CP001606.PE305       Location/Qualifiers
FT   CDS             383489..385363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0315"
FT                   /product="JadJ"
FT                   /note="COG4770 Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47270"
FT                   /protein_id="ACS47270.1"
FT                   /translation="MTDTVSKLLIVNRGEIALRVVRTAREMGIPTVVVYAEQDRHSQYV
FT                   KMADEAFLLSGDTYADTYLNEDLLIDILRRSGADAVHPGYGFLSEVPSFADKVIEAGAT
FT                   WVGPSSRALTDLGDKISARRVAVYAKVPPVPGISHSLGDMRVLLDFAHTHGYPLMLKRA
FT                   DGGGGRGITLVRDDDELRGFYLNHNAVQGGDLDEYFVERFIDHGRHVETQCGRDSHGNF
FT                   TVYSTRDCSVQRRNQKLIEEAPAPFLGDDVVEQLHAYSHRLFDAVDYVGLGTCEFMVTD
FT                   AGKVYFLEVNPRLQVEHTVSEEVSGLDLVREQLQIAAGGKVSPEPTARGHSFELRITSE
FT                   DPKTNLTPSSGTLERVQWPAGPGVRVDSGVVEGDTISPKFDSMMGKLIVTAHSRQAAVA
FT                   RVRRALDELRIEGVPTPVELYRQVFGDDEFTAEHGHGFDVSTKWLERKYLNHEPATVHG
FT                   GQPASLDAGAGAAEPELDHSEQFVIEMNNRRVVLNVPSDMFANLTGAARSHGERRPTQP
FT                   LRGQGSHHVDRGNARTAERPGVISAPMQALVTRINVSEGQQVAKGDLLVVLESMKMENY
FT                   VYSPANGTVKEIFASPATGVEAGETLLTMEVAGTSKPANPTTDTTEEA"
     MTDTVSKLLI VNRGEIALRV VRTAREMGIP TVVVYAEQDR HSQYVKMADE AFLLSGDTYA        60
     DTYLNEDLLI DILRRSGADA VHPGYGFLSE VPSFADKVIE AGATWVGPSS RALTDLGDKI       120
     SARRVAVYAK VPPVPGISHS LGDMRVLLDF AHTHGYPLML KRADGGGGRG ITLVRDDDEL       180
     RGFYLNHNAV QGGDLDEYFV ERFIDHGRHV ETQCGRDSHG NFTVYSTRDC SVQRRNQKLI       240
     EEAPAPFLGD DVVEQLHAYS HRLFDAVDYV GLGTCEFMVT DAGKVYFLEV NPRLQVEHTV       300
     SEEVSGLDLV REQLQIAAGG KVSPEPTARG HSFELRITSE DPKTNLTPSS GTLERVQWPA       360
     GPGVRVDSGV VEGDTISPKF DSMMGKLIVT AHSRQAAVAR VRRALDELRI EGVPTPVELY       420
     RQVFGDDEFT AEHGHGFDVS TKWLERKYLN HEPATVHGGQ PASLDAGAGA AEPELDHSEQ       480
     FVIEMNNRRV VLNVPSDMFA NLTGAARSHG ERRPTQPLRG QGSHHVDRGN ARTAERPGVI       540
     SAPMQALVTR INVSEGQQVA KGDLLVVLES MKMENYVYSP ANGTVKEIFA SPATGVEAGE       600
     TLLTMEVAGT SKPANPTTDT TEEA                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page