(data stored in ACNUC30630 zone)

EMBL: CP001606.PE318

CP001606.PE318       Location/Qualifiers
FT   CDS             complement(409362..409625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0329"
FT                   /product="glutaredoxin-like protein NrdH"
FT                   /note="COG0695 Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47283"
FT                   /protein_id="ACS47283.1"
FT                   /translation="MHITIYSKPNCPQCAATKRAFDRLGAPYTVVDITTDPVALATLQE
FT                   AGFRQAPVVFVDSDFWTGYRPDRIRDVARRLQTVSSASGVLA"
     MHITIYSKPN CPQCAATKRA FDRLGAPYTV VDITTDPVAL ATLQEAGFRQ APVVFVDSDF        60
     WTGYRPDRIR DVARRLQTVS SASGVLA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page