(data stored in ACNUC30630 zone)

EMBL: CP001606.PE334

CP001606.PE334       Location/Qualifiers
FT   CDS             429162..430154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0345"
FT                   /product="phosphate ABC transporter phosphate-binding
FT                   protein"
FT                   /note="COG0581 ABC-type phosphate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47299"
FT                   /protein_id="ACS47299.1"
FT                   /translation="MMSEPQSTPHADAAPVIDFDKFKPTRSYTAARKRKDMVMRALIIL
FT                   AFVVALIPLISVLWTTLAHGIRRLNWDFLSHNMTNVIGGNQTPSGGYGGILHAIIGTLE
FT                   ITLGAMVISIPIGVMCAVYLIEYAGKSKLARTIHLLVDVMSGIPSIVAGLFAYSMFAIL
FT                   VGPGTLNGFEGSVALSLLMIPTVVKTTEEMLKIVPNDLREASLALGVTKQRTITKVVLR
FT                   TALSGIVSGSILAIARVIGETAPLLMTAGYIVSTNANLFLGEMTTLPVYVYQEYSKYHA
FT                   NCPADAGSGCVTAIPMERAWSAALVLIVIVLILNLIGRIVAKVFAPKKK"
     MMSEPQSTPH ADAAPVIDFD KFKPTRSYTA ARKRKDMVMR ALIILAFVVA LIPLISVLWT        60
     TLAHGIRRLN WDFLSHNMTN VIGGNQTPSG GYGGILHAII GTLEITLGAM VISIPIGVMC       120
     AVYLIEYAGK SKLARTIHLL VDVMSGIPSI VAGLFAYSMF AILVGPGTLN GFEGSVALSL       180
     LMIPTVVKTT EEMLKIVPND LREASLALGV TKQRTITKVV LRTALSGIVS GSILAIARVI       240
     GETAPLLMTA GYIVSTNANL FLGEMTTLPV YVYQEYSKYH ANCPADAGSG CVTAIPMERA       300
     WSAALVLIVI VLILNLIGRI VAKVFAPKKK                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page