(data stored in ACNUC30630 zone)

EMBL: CP001606.PE340

CP001606.PE340       Location/Qualifiers
FT   CDS             435508..437082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0351"
FT                   /product="Tfp pilus assembly protein"
FT                   /note="COG1716 FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47305"
FT                   /protein_id="ACS47305.1"
FT                   /translation="MASVEPGTTVEIGRKPLRPLPDDGKRRVEILDDSRSVSKRHAQLM
FT                   VALDGRAFLRDLNSTNGTFVVRAGDELVRLQSGVDYPLQSDSVHVQFGDVPVDFTKFIE
FT                   DDDSTKDDAPVVNLFDYAVEGSSNEPEAADMSVDDILNLRAGEPTDIFNASMVRARAKR
FT                   MHDAEQQSFVPFTQPINPLPMQDLDDSDAGDAAPRDLFADAKDVAEGKISEPAAAQEHP
FT                   YIPKMSDKPKHAGAPADRLISVSELASAHPRSMPQPQENMPEPAAEVDAASESIVVEQT
FT                   SVTEETTQEEPAEPVAAEPAAQGIGEHGESVQPSANAPAVEEPDGNAEESAAASEQAPV
FT                   SDEESRQNEEPSGSAGTTSDEAASETEVNGDIASLAAQDVSQDEQELRGDNAPEVATVT
FT                   VDAADVDYSRFQRHDEPQTDESAEGEYEPAFEPGSVFEKVANGDFAKSEPLVSVAGFTS
FT                   DDARRSDDFSEQFEMARHPELLPFLAMNPSLYDDLYTWLAAQGNADIDEALSKNAGYED
FT                   YRKAMGK"
     MASVEPGTTV EIGRKPLRPL PDDGKRRVEI LDDSRSVSKR HAQLMVALDG RAFLRDLNST        60
     NGTFVVRAGD ELVRLQSGVD YPLQSDSVHV QFGDVPVDFT KFIEDDDSTK DDAPVVNLFD       120
     YAVEGSSNEP EAADMSVDDI LNLRAGEPTD IFNASMVRAR AKRMHDAEQQ SFVPFTQPIN       180
     PLPMQDLDDS DAGDAAPRDL FADAKDVAEG KISEPAAAQE HPYIPKMSDK PKHAGAPADR       240
     LISVSELASA HPRSMPQPQE NMPEPAAEVD AASESIVVEQ TSVTEETTQE EPAEPVAAEP       300
     AAQGIGEHGE SVQPSANAPA VEEPDGNAEE SAAASEQAPV SDEESRQNEE PSGSAGTTSD       360
     EAASETEVNG DIASLAAQDV SQDEQELRGD NAPEVATVTV DAADVDYSRF QRHDEPQTDE       420
     SAEGEYEPAF EPGSVFEKVA NGDFAKSEPL VSVAGFTSDD ARRSDDFSEQ FEMARHPELL       480
     PFLAMNPSLY DDLYTWLAAQ GNADIDEALS KNAGYEDYRK AMGK                        524
//

If you have problems or comments...

PBIL Back to PBIL home page