(data stored in ACNUC30630 zone)

EMBL: CP001606.PE356

CP001606.PE356       Location/Qualifiers
FT   CDS             454287..454922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0371"
FT                   /product="hypothetical protein"
FT                   /note="COG1739 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47321"
FT                   /protein_id="ACS47321.1"
FT                   /translation="MRTLLNPADEPAHDAFVEKKSEFIGDACHVDSLEDALAFVETVRE
FT                   RHPKARHVAYAAIVTGDDGRVMERMSDDGEPSGTAGKPILDVLRANELTDCVIAVTRYF
FT                   GGILLGSGGLIRAYSTGASIAVKAADVAQIVVCARYAVPLDYSQLGPMRHLVEVMGAVE
FT                   ESADFSDHVVLIVLVRDDARESFEHRVREQFSATVTPEYVGRCHRAMR"
     MRTLLNPADE PAHDAFVEKK SEFIGDACHV DSLEDALAFV ETVRERHPKA RHVAYAAIVT        60
     GDDGRVMERM SDDGEPSGTA GKPILDVLRA NELTDCVIAV TRYFGGILLG SGGLIRAYST       120
     GASIAVKAAD VAQIVVCARY AVPLDYSQLG PMRHLVEVMG AVEESADFSD HVVLIVLVRD       180
     DARESFEHRV REQFSATVTP EYVGRCHRAM R                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page